SIK2 monoclonal antibody (M01), clone 4H6
  • SIK2 monoclonal antibody (M01), clone 4H6

SIK2 monoclonal antibody (M01), clone 4H6

Ref: AB-H00023235-M01
SIK2 monoclonal antibody (M01), clone 4H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIK2.
Información adicional
Size 100 ug
Gene Name SIK2
Gene Alias DKFZp434K1115|KIAA0781|LOH11CR1I|QIK|SNF1LK2
Gene Description salt-inducible kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq AHAFEAFQSTRSGQRRHTLSEVTNQLVVMPGAGKIFSMNDSPSLDSVDSEYDMGSVQRDLNFLEDNPSLKDIMLANQPSPRMTSPFISLRPTNPAMQALSSQKREVHNRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIK2 (NP_056006, 467 a.a. ~ 576 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23235
Clone Number 4H6
Iso type IgG2a Kappa

Enviar uma mensagem


SIK2 monoclonal antibody (M01), clone 4H6

SIK2 monoclonal antibody (M01), clone 4H6