SYNE2 monoclonal antibody (M01), clone 5E5 View larger

Mouse monoclonal antibody raised against a partial recombinant SYNE2.

AB-H00023224-M01

New product

SYNE2 monoclonal antibody (M01), clone 5E5

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name SYNE2
Gene Alias DKFZp434H2235|DKFZp686E01115|DKFZp686H1931|FLJ11014|FLJ43727|FLJ45710|FLJ46790|KIAA1011|NUA|NUANCE|Nesprin-2|SYNE-2
Gene Description spectrin repeat containing, nuclear envelope 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SYNE2 (NP_055995, 6702 a.a. ~ 6799 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23224
Clone Number 5E5
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant SYNE2.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant SYNE2.

Mouse monoclonal antibody raised against a partial recombinant SYNE2.