SYNE2 monoclonal antibody (M01), clone 5E5
  • SYNE2 monoclonal antibody (M01), clone 5E5

SYNE2 monoclonal antibody (M01), clone 5E5

Ref: AB-H00023224-M01
SYNE2 monoclonal antibody (M01), clone 5E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SYNE2.
Información adicional
Size 100 ug
Gene Name SYNE2
Gene Alias DKFZp434H2235|DKFZp686E01115|DKFZp686H1931|FLJ11014|FLJ43727|FLJ45710|FLJ46790|KIAA1011|NUA|NUANCE|Nesprin-2|SYNE-2
Gene Description spectrin repeat containing, nuclear envelope 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SYNE2 (NP_055995, 6702 a.a. ~ 6799 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23224
Clone Number 5E5
Iso type IgG2b Kappa

Enviar uma mensagem


SYNE2 monoclonal antibody (M01), clone 5E5

SYNE2 monoclonal antibody (M01), clone 5E5