TBC1D1 MaxPab rabbit polyclonal antibody (D01)
  • TBC1D1 MaxPab rabbit polyclonal antibody (D01)

TBC1D1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00023216-D01
TBC1D1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TBC1D1 protein.
Información adicional
Size 100 uL
Gene Name TBC1D1
Gene Alias KIAA1108|TBC|TBC1
Gene Description TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MEPITFTARKHLLSNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSTRKEPVTKQVRLCVSPSGLRCEPEPGRSQQWDPLIYSSIFECKPQRVHKLIHNSHDPSYFACLIKEDAVHRQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGRVTVAHKKAPPALIDECIEKFNHVSGSRGSESPRPNPPHAAPTGSQEPVRRPMRKSFSQPGLRSLAFRKELQDGGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TBC1D1 (AAH50321.3, 1 a.a. ~ 1168 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 23216

Enviar uma mensagem


TBC1D1 MaxPab rabbit polyclonal antibody (D01)

TBC1D1 MaxPab rabbit polyclonal antibody (D01)