TBC1D1 purified MaxPab mouse polyclonal antibody (B02P)
  • TBC1D1 purified MaxPab mouse polyclonal antibody (B02P)

TBC1D1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00023216-B02P
TBC1D1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TBC1D1 protein.
Información adicional
Size 50 ug
Gene Name TBC1D1
Gene Alias KIAA1108|TBC|TBC1
Gene Description TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEPITFTARKHLLSNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSTRKEPVTKQVRLCVSPSGLRCEPEPGRSQQWDPLIYSSIFECKPQRVHKLIHNSHDPSYFACLIKEDAVHRQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGRVTVAHKKAPPALIDECIEKFNHVSGSRGSESPRPNPPHAAPTGSQEPVRRPMRKSFSQPGLRSLAFRKELQDGGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TBC1D1 (AAH50321.3, 1 a.a. ~ 1168 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23216

Enviar uma mensagem


TBC1D1 purified MaxPab mouse polyclonal antibody (B02P)

TBC1D1 purified MaxPab mouse polyclonal antibody (B02P)