SULF1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SULF1 purified MaxPab rabbit polyclonal antibody (D01P)

SULF1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023213-D01P
SULF1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SULF1 protein.
Información adicional
Size 100 ug
Gene Name SULF1
Gene Alias FLJ30905|FLJ38022|FLJ41750|HSULF-1|KIAA1077|SULF-1
Gene Description sulfatase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKYSCCALVLAVLGTELLGSLCSTVRSPRFRGRIQQERKNIRPNIILVLTDDQDVELGSLQVMNKTRKIMEHGGATFINAFVTTPMCCPSRSSMLTGKYVHNHNVYTNNENCSSPSWQAMHEPRTFAVYLNNTGYRTAFFGKYLNEYNGSYIPPGWREWLGLIKNSRFYNYTVCRNGIKEKHGFDYAKDYFTDLITNESINYFKMSKRMYPHRPVMMVISHAAPHGPEDSAPQFSKLYPNASQHITPSYNYAPNM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SULF1 (NP_055985.1, 1 a.a. ~ 871 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23213

Enviar uma mensagem


SULF1 purified MaxPab rabbit polyclonal antibody (D01P)

SULF1 purified MaxPab rabbit polyclonal antibody (D01P)