SYT11 monoclonal antibody (M03), clone 4E1
  • SYT11 monoclonal antibody (M03), clone 4E1

SYT11 monoclonal antibody (M03), clone 4E1

Ref: AB-H00023208-M03
SYT11 monoclonal antibody (M03), clone 4E1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SYT11.
Información adicional
Size 100 ug
Gene Name SYT11
Gene Alias DKFZp781D015|KIAA0080|MGC10881|MGC17226|SYT12
Gene Description synaptotagmin XI
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq GPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SYT11 (NP_689493, 84 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23208
Clone Number 4E1
Iso type IgG1 Kappa

Enviar uma mensagem


SYT11 monoclonal antibody (M03), clone 4E1

SYT11 monoclonal antibody (M03), clone 4E1