FBXL7 monoclonal antibody (M01), clone 2G10
  • FBXL7 monoclonal antibody (M01), clone 2G10

FBXL7 monoclonal antibody (M01), clone 2G10

Ref: AB-H00023194-M01
FBXL7 monoclonal antibody (M01), clone 2G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FBXL7.
Información adicional
Size 100 ug
Gene Name FBXL7
Gene Alias FBL6|FBL7
Gene Description F-box and leucine-rich repeat protein 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq HGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXL7 (NP_036436, 392 a.a. ~ 489 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23194
Clone Number 2G10
Iso type IgG2b Kappa

Enviar uma mensagem


FBXL7 monoclonal antibody (M01), clone 2G10

FBXL7 monoclonal antibody (M01), clone 2G10