PASK polyclonal antibody (A01)
  • PASK polyclonal antibody (A01)

PASK polyclonal antibody (A01)

Ref: AB-H00023178-A01
PASK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PASK.
Información adicional
Size 50 uL
Gene Name PASK
Gene Alias DKFZp434O051|DKFZp686P2031|KIAA0135|PASKIN|STK37
Gene Description PAS domain containing serine/threonine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQSRTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PASK (AAH63585, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23178

Enviar uma mensagem


PASK polyclonal antibody (A01)

PASK polyclonal antibody (A01)