METAP1 purified MaxPab mouse polyclonal antibody (B01P)
  • METAP1 purified MaxPab mouse polyclonal antibody (B01P)

METAP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023173-B01P
METAP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human METAP1 protein.
Información adicional
Size 50 ug
Gene Name METAP1
Gene Alias DKFZp781C0419|KIAA0094
Gene Description methionyl aminopeptidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen METAP1 (NP_055958.1, 1 a.a. ~ 272 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23173

Enviar uma mensagem


METAP1 purified MaxPab mouse polyclonal antibody (B01P)

METAP1 purified MaxPab mouse polyclonal antibody (B01P)