RTF1 MaxPab mouse polyclonal antibody (B01P)
  • RTF1 MaxPab mouse polyclonal antibody (B01P)

RTF1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023168-B01P
RTF1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RTF1 protein.
Información adicional
Size 50 ug
Gene Name RTF1
Gene Alias CDG1N|GTL7|KIAA0252
Gene Description Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHDGYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKKKKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAELLAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RTF1 (NP_055953.1, 1 a.a. ~ 585 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23168

Enviar uma mensagem


RTF1 MaxPab mouse polyclonal antibody (B01P)

RTF1 MaxPab mouse polyclonal antibody (B01P)