EPB41L3 purified MaxPab mouse polyclonal antibody (B01P)
  • EPB41L3 purified MaxPab mouse polyclonal antibody (B01P)

EPB41L3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023136-B01P
EPB41L3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EPB41L3 protein.
Información adicional
Size 50 ug
Gene Name EPB41L3
Gene Alias 4.1B|DAL-1|DAL1|FLJ37633|KIAA0987
Gene Description erythrocyte membrane protein band 4.1-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAAAAHSTPVRREVTDKEQEFAARAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDECGSDYISEFRF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EPB41L3 (AAH06141.1, 1 a.a. ~ 865 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23136

Enviar uma mensagem


EPB41L3 purified MaxPab mouse polyclonal antibody (B01P)

EPB41L3 purified MaxPab mouse polyclonal antibody (B01P)