HIC2 purified MaxPab mouse polyclonal antibody (B01P)
  • HIC2 purified MaxPab mouse polyclonal antibody (B01P)

HIC2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023119-B01P
HIC2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HIC2 protein.
Información adicional
Size 50 ug
Gene Name HIC2
Gene Alias HRG22|KIAA1020|ZBTB30
Gene Description hypermethylated in cancer 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MVSGPLALRWCAWAGRGDMGPDMELPSHSKQLLLQLNQQRTKGFLCDVIIMVENSIFRAHKNVLAASSIYFKSLVLHDNLINLDTDMVSSTVFQQILDFIYTGKLLPSDQPAEPNFSTLLTAASYLQLPELAALCRRKLKRAGKPFGSGRAGSTGMGRPPRSQRLSTASVIQARYQGLVDGRKGAHAPQELPQAKGSDDELFLGGSNQDSVQGLGRAVCPAGGEAGLGGCSSSTNGSSGGCEQELGLDLSKKSPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HIC2 (AAH94787.1, 1 a.a. ~ 615 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23119

Enviar uma mensagem


HIC2 purified MaxPab mouse polyclonal antibody (B01P)

HIC2 purified MaxPab mouse polyclonal antibody (B01P)