MAP3K7IP2 MaxPab rabbit polyclonal antibody (D01)
  • MAP3K7IP2 MaxPab rabbit polyclonal antibody (D01)

MAP3K7IP2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00023118-D01
MAP3K7IP2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MAP3K7IP2 protein.
Información adicional
Size 100 uL
Gene Name MAP3K7IP2
Gene Alias FLJ21885|KIAA0733|TAB2
Gene Description mitogen-activated protein kinase kinase kinase 7 interacting protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSELFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVTLAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFNPMNPQQVYQPSQPGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAP3K7IP2 (NP_055908.1, 1 a.a. ~ 693 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 23118

Enviar uma mensagem


MAP3K7IP2 MaxPab rabbit polyclonal antibody (D01)

MAP3K7IP2 MaxPab rabbit polyclonal antibody (D01)