NFASC polyclonal antibody (A01)
  • NFASC polyclonal antibody (A01)

NFASC polyclonal antibody (A01)

Ref: AB-H00023114-A01
NFASC polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NFASC.
Información adicional
Size 50 uL
Gene Name NFASC
Gene Alias DKFZp686P2250|FLJ46866|KIAA0756|NF|NRCAML
Gene Description neurofascin homolog (chicken)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NFASC (NP_001005388, 661 a.a. ~ 758 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23114

Enviar uma mensagem


NFASC polyclonal antibody (A01)

NFASC polyclonal antibody (A01)