MRPS27 MaxPab mouse polyclonal antibody (B01)
  • MRPS27 MaxPab mouse polyclonal antibody (B01)

MRPS27 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00023107-B01
MRPS27 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human MRPS27 protein.
Información adicional
Size 50 uL
Gene Name MRPS27
Gene Alias FLJ21764|FLJ23348|KIAA0264|MRP-S27|S27mt
Gene Description mitochondrial ribosomal protein S27
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPS27 (AAH30521, 1 a.a. ~ 168 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 23107

Enviar uma mensagem


MRPS27 MaxPab mouse polyclonal antibody (B01)

MRPS27 MaxPab mouse polyclonal antibody (B01)