FSTL4 purified MaxPab mouse polyclonal antibody (B01P)
  • FSTL4 purified MaxPab mouse polyclonal antibody (B01P)

FSTL4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023105-B01P
FSTL4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FSTL4 protein.
Información adicional
Size 50 ug
Gene Name FSTL4
Gene Alias -
Gene Description follistatin-like 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKPGGFWLHLTLLGASLPAALGWMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGSDGRFYENHCKLHRAACLLGKRITVIHSKDCFLKGDTCTMAGYARLKNVLLALQTRLQPLQEGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELAQHVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYIAFQVVQLSLAPEDRV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FSTL4 (AAH24300.1, 1 a.a. ~ 605 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23105

Enviar uma mensagem


FSTL4 purified MaxPab mouse polyclonal antibody (B01P)

FSTL4 purified MaxPab mouse polyclonal antibody (B01P)