KIF1B polyclonal antibody (A01)
  • KIF1B polyclonal antibody (A01)

KIF1B polyclonal antibody (A01)

Ref: AB-H00023095-A01
KIF1B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant KIF1B.
Información adicional
Size 50 uL
Gene Name KIF1B
Gene Alias CMT2|CMT2A|CMT2A1|FLJ23699|HMSNII|KIAA0591|KIAA1448|KLP|MGC134844
Gene Description kinesin family member 1B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSKTSLGQSMSKYDLLVWFEISELEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELVVGRIRNKPEVDEAAVDAILSLNIISAKYLKSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTGIYELSLCKMSDTGSPGMQRRRRKILDTSVAYVRGEENLAGWRPRGDSLILEH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIF1B (AAH01415, 1 a.a. ~ 579 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23095

Enviar uma mensagem


KIF1B polyclonal antibody (A01)

KIF1B polyclonal antibody (A01)