TRIM35 purified MaxPab rabbit polyclonal antibody (D01P)
  • TRIM35 purified MaxPab rabbit polyclonal antibody (D01P)

TRIM35 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023087-D01P
TRIM35 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TRIM35 protein.
Información adicional
Size 100 ug
Gene Name TRIM35
Gene Alias HLS5|KIAA1098|MAIR|MGC17233
Gene Description tripartite motif-containing 35
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLCCSCQADPRHQGHRVQPVKDTAHDFRAKCRNMEHALREKAKAFWAMRRSYEAIAKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIERLQMEMKEDDVSFLMK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM35 (NP_741983.2, 1 a.a. ~ 493 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23087

Enviar uma mensagem


TRIM35 purified MaxPab rabbit polyclonal antibody (D01P)

TRIM35 purified MaxPab rabbit polyclonal antibody (D01P)