TXNDC4 purified MaxPab rabbit polyclonal antibody (D01P)
  • TXNDC4 purified MaxPab rabbit polyclonal antibody (D01P)

TXNDC4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023071-D01P
TXNDC4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TXNDC4 protein.
Información adicional
Size 100 ug
Gene Name TXNDC4
Gene Alias ERP44|KIAA0573
Gene Description thioredoxin domain containing 4 (endoplasmic reticulum)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TXNDC4 (NP_055866.1, 1 a.a. ~ 406 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23071

Enviar uma mensagem


TXNDC4 purified MaxPab rabbit polyclonal antibody (D01P)

TXNDC4 purified MaxPab rabbit polyclonal antibody (D01P)