TXNDC4 polyclonal antibody (A01)
  • TXNDC4 polyclonal antibody (A01)

TXNDC4 polyclonal antibody (A01)

Ref: AB-H00023071-A01
TXNDC4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TXNDC4.
Información adicional
Size 50 uL
Gene Name TXNDC4
Gene Alias ERP44|KIAA0573
Gene Description thioredoxin domain containing 4 (endoplasmic reticulum)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TXNDC4 (AAH05374, 30 a.a. ~ 406 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23071

Enviar uma mensagem


TXNDC4 polyclonal antibody (A01)

TXNDC4 polyclonal antibody (A01)