CLUAP1 monoclonal antibody (M05), clone 6E12
  • CLUAP1 monoclonal antibody (M05), clone 6E12

CLUAP1 monoclonal antibody (M05), clone 6E12

Ref: AB-H00023059-M05
CLUAP1 monoclonal antibody (M05), clone 6E12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CLUAP1.
Información adicional
Size 100 ug
Gene Name CLUAP1
Gene Alias FLJ13297|KIAA0643
Gene Description clusterin associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRMEQERFEEAKNTLCLIQNKLKEEEKRLLKSGSNDDSDIDIQEDDESDSELEERRLPKPQTAMEMLMQGRPGKRIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRVRKSEPLDESDNDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CLUAP1 (NP_079069.1, 1 a.a. ~ 247 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23059
Clone Number 6E12
Iso type IgG2a Kappa

Enviar uma mensagem


CLUAP1 monoclonal antibody (M05), clone 6E12

CLUAP1 monoclonal antibody (M05), clone 6E12