USP33 purified MaxPab rabbit polyclonal antibody (D01P)
  • USP33 purified MaxPab rabbit polyclonal antibody (D01P)

USP33 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00023032-D01P
USP33 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human USP33 protein.
Información adicional
Size 100 ug
Gene Name USP33
Gene Alias KIAA1097|MGC16868|VDU1
Gene Description ubiquitin specific peptidase 33
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSAFRNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFLRCLMDLLHEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP33 (NP_963918.1, 1 a.a. ~ 911 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23032

Enviar uma mensagem


USP33 purified MaxPab rabbit polyclonal antibody (D01P)

USP33 purified MaxPab rabbit polyclonal antibody (D01P)