AOF2 monoclonal antibody (M04), clone 2E7
  • AOF2 monoclonal antibody (M04), clone 2E7

AOF2 monoclonal antibody (M04), clone 2E7

Ref: AB-H00023028-M04
AOF2 monoclonal antibody (M04), clone 2E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AOF2.
Información adicional
Size 100 ug
Gene Name AOF2
Gene Alias BHC110|KDM1|KIAA0601|LSD1
Gene Description amine oxidase (flavin containing) domain 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq ADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AOF2 (NP_055828, 753 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23028
Clone Number 2E7
Iso type IgG2a Kappa

Enviar uma mensagem


AOF2 monoclonal antibody (M04), clone 2E7

AOF2 monoclonal antibody (M04), clone 2E7