RAB21 monoclonal antibody (M01), clone 1F6
  • RAB21 monoclonal antibody (M01), clone 1F6

RAB21 monoclonal antibody (M01), clone 1F6

Ref: AB-H00023011-M01
RAB21 monoclonal antibody (M01), clone 1F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAB21.
Información adicional
Size 100 ug
Gene Name RAB21
Gene Alias KIAA0118
Gene Description RAB21, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq ELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB21 (NP_055814, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23011
Clone Number 1F6
Iso type IgG1 Kappa

Enviar uma mensagem


RAB21 monoclonal antibody (M01), clone 1F6

RAB21 monoclonal antibody (M01), clone 1F6