RAB21 polyclonal antibody (A01)
  • RAB21 polyclonal antibody (A01)

RAB21 polyclonal antibody (A01)

Ref: AB-H00023011-A01
RAB21 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAB21.
Información adicional
Size 50 uL
Gene Name RAB21
Gene Alias KIAA0118
Gene Description RAB21, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB21 (NP_055814, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23011

Enviar uma mensagem


RAB21 polyclonal antibody (A01)

RAB21 polyclonal antibody (A01)