DAAM1 polyclonal antibody (A01)
  • DAAM1 polyclonal antibody (A01)

DAAM1 polyclonal antibody (A01)

Ref: AB-H00023002-A01
DAAM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DAAM1.
Información adicional
Size 50 uL
Gene Name DAAM1
Gene Alias FLJ41657|KIAA0666
Gene Description dishevelled associated activator of morphogenesis 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAAM1 (NP_055807, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23002

Enviar uma mensagem


DAAM1 polyclonal antibody (A01)

DAAM1 polyclonal antibody (A01)