SCMH1 monoclonal antibody (M02), clone 1H2
  • SCMH1 monoclonal antibody (M02), clone 1H2

SCMH1 monoclonal antibody (M02), clone 1H2

Ref: AB-H00022955-M02
SCMH1 monoclonal antibody (M02), clone 1H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCMH1.
Información adicional
Size 100 ug
Gene Name SCMH1
Gene Alias Scml3
Gene Description sex comb on midleg homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EKLCHNLRSDNLFGNQPFTQTHLSLTAIEYSHSHDRYLPGETFVLGNSLARSLEPHSDSMDSASNPTNLVSTSQRHRPLLSSCGLPPSTASAVRRLCSR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCMH1 (NP_036368, 404 a.a. ~ 502 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22955
Clone Number 1H2
Iso type IgG2a Kappa

Enviar uma mensagem


SCMH1 monoclonal antibody (M02), clone 1H2

SCMH1 monoclonal antibody (M02), clone 1H2