SCMH1 purified MaxPab mouse polyclonal antibody (B01P)
  • SCMH1 purified MaxPab mouse polyclonal antibody (B01P)

SCMH1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00022955-B01P
SCMH1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SCMH1 protein.
Información adicional
Size 50 ug
Gene Name SCMH1
Gene Alias Scml3
Gene Description sex comb on midleg homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLVCYSVLACEILWDLPCSIMGSPLGHFTWDKYLKETCSVPAPVHCFKQSYTPPSNEFKISMKLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSAEIQPIGNCEKNGGMLQPPLGFRLNASSWPMFLLKTLNGAEMAPIRIFHKEPPSPSHNFFKMGMKLEAVDRKNPHFICPATIGEVRGSEVLVTFDGWRGAFDYWCRFDSRDIFPVGWCSLTGDNLQPPGTKVVIPKNPYPASDVNTEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SCMH1 (NP_001026864.1, 1 a.a. ~ 660 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22955

Enviar uma mensagem


SCMH1 purified MaxPab mouse polyclonal antibody (B01P)

SCMH1 purified MaxPab mouse polyclonal antibody (B01P)