SCMH1 polyclonal antibody (A01)
  • SCMH1 polyclonal antibody (A01)

SCMH1 polyclonal antibody (A01)

Ref: AB-H00022955-A01
SCMH1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SCMH1.
Información adicional
Size 50 uL
Gene Name SCMH1
Gene Alias Scml3
Gene Description sex comb on midleg homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EKLCHNLRSDNLFGNQPFTQTHLSLTAIEYSHSHDRYLPGETFVLGNSLARSLEPHSDSMDSASNPTNLVSTSQRHRPLLSSCGLPPSTASAVRRLCSR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCMH1 (NP_036368, 404 a.a. ~ 502 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22955

Enviar uma mensagem


SCMH1 polyclonal antibody (A01)

SCMH1 polyclonal antibody (A01)