P2RX2 monoclonal antibody (M02), clone 3D5
  • P2RX2 monoclonal antibody (M02), clone 3D5

P2RX2 monoclonal antibody (M02), clone 3D5

Ref: AB-H00022953-M02
P2RX2 monoclonal antibody (M02), clone 3D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant P2RX2.
Información adicional
Size 50 ug
Gene Name P2RX2
Gene Alias MGC129601|P2X2
Gene Description purinergic receptor P2X, ligand-gated ion channel, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen P2RX2 (NP_036358.2, 128 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22953
Clone Number 3D5
Iso type IgG2a Kappa

Enviar uma mensagem


P2RX2 monoclonal antibody (M02), clone 3D5

P2RX2 monoclonal antibody (M02), clone 3D5