SLC4A1AP purified MaxPab mouse polyclonal antibody (B01P)
  • SLC4A1AP purified MaxPab mouse polyclonal antibody (B01P)

SLC4A1AP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00022950-B01P
SLC4A1AP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SLC4A1AP protein.
Información adicional
Size 50 ug
Gene Name SLC4A1AP
Gene Alias FLJ10624|FLJ41004|HLC3|MGC120646|MGC120648
Gene Description solute carrier family 4 (anion exchanger), member 1, adaptor protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MLAPLRNAPGREGATSPSPPTDATGSLGEWDVDRNVKTEGWVSKERISKLHRLRMADILSQSETLASQDLSGDFKKPALPVSPAARSKAPASSSSNPEEVQKEGPTALQDSNSGEPDIPPPQPDCGDFRSLQEEQSRPPTAVSSPGGPARAPPYQEPPWGGPATAPYSLETLKGGTILGTRSLKGTSYCLFGRLSGCDVCLEHPSVSRYHAVLQHRASGPDGECDSNGPGFYLYDLGSTHGTFLNKTRIPPRTYC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC4A1AP (NP_060628.1, 1 a.a. ~ 796 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22950

Enviar uma mensagem


SLC4A1AP purified MaxPab mouse polyclonal antibody (B01P)

SLC4A1AP purified MaxPab mouse polyclonal antibody (B01P)