DKK1 monoclonal antibody (M19), clone 3H7
  • DKK1 monoclonal antibody (M19), clone 3H7

DKK1 monoclonal antibody (M19), clone 3H7

Ref: AB-H00022943-M19
DKK1 monoclonal antibody (M19), clone 3H7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant DKK1.
Información adicional
Size 100 ug
Gene Name DKK1
Gene Alias DKK-1|SK
Gene Description dickkopf homolog 1 (Xenopus laevis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq RTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DKK1 (NP_036374, 171 a.a. ~ 266 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22943
Clone Number 3H7
Iso type IgG2a Kappa

Enviar uma mensagem


DKK1 monoclonal antibody (M19), clone 3H7

DKK1 monoclonal antibody (M19), clone 3H7