DKK1 purified MaxPab rabbit polyclonal antibody (D01P)
  • DKK1 purified MaxPab rabbit polyclonal antibody (D01P)

DKK1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00022943-D01P
DKK1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DKK1 protein.
Información adicional
Size 100 ug
Gene Name DKK1
Gene Alias DKK-1|SK
Gene Description dickkopf homolog 1 (Xenopus laevis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DKK1 (NP_036374.1, 1 a.a. ~ 266 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22943

Enviar uma mensagem


DKK1 purified MaxPab rabbit polyclonal antibody (D01P)

DKK1 purified MaxPab rabbit polyclonal antibody (D01P)