DKK1 polyclonal antibody (A01)
  • DKK1 polyclonal antibody (A01)

DKK1 polyclonal antibody (A01)

Ref: AB-H00022943-A01
DKK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DKK1.
Información adicional
Size 50 uL
Gene Name DKK1
Gene Alias DKK-1|SK
Gene Description dickkopf homolog 1 (Xenopus laevis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DKK1 (NP_036374, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22943

Enviar uma mensagem


DKK1 polyclonal antibody (A01)

DKK1 polyclonal antibody (A01)