ELL2 polyclonal antibody (A01)
  • ELL2 polyclonal antibody (A01)

ELL2 polyclonal antibody (A01)

Ref: AB-H00022936-A01
ELL2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ELL2.
Información adicional
Size 50 uL
Gene Name ELL2
Gene Alias -
Gene Description elongation factor, RNA polymerase II, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLNPSQNATGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNKKARISHLTNRVPPTLNGHL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ELL2 (NP_036213, 253 a.a. ~ 352 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22936

Enviar uma mensagem


ELL2 polyclonal antibody (A01)

ELL2 polyclonal antibody (A01)