SIRT2 purified MaxPab mouse polyclonal antibody (B01P)
  • SIRT2 purified MaxPab mouse polyclonal antibody (B01P)

SIRT2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00022933-B01P
SIRT2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SIRT2 protein.
Información adicional
Size 50 ug
Gene Name SIRT2
Gene Alias SIR2|SIR2L|SIR2L2
Gene Description sirtuin (silent mating type information regulation 2 homolog) 2 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIRT2 (NP_085096.1, 1 a.a. ~ 352 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22933

Enviar uma mensagem


SIRT2 purified MaxPab mouse polyclonal antibody (B01P)

SIRT2 purified MaxPab mouse polyclonal antibody (B01P)