RAB18 monoclonal antibody (M03), clone 4C8
  • RAB18 monoclonal antibody (M03), clone 4C8

RAB18 monoclonal antibody (M03), clone 4C8

Ref: AB-H00022931-M03
RAB18 monoclonal antibody (M03), clone 4C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAB18.
Información adicional
Size 100 ug
Gene Name RAB18
Gene Alias RAB18LI1
Gene Description RAB18, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB18 (AAH15014, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22931
Clone Number 4C8
Iso type IgG2a Kappa

Enviar uma mensagem


RAB18 monoclonal antibody (M03), clone 4C8

RAB18 monoclonal antibody (M03), clone 4C8