RAB18 polyclonal antibody (A01)
  • RAB18 polyclonal antibody (A01)

RAB18 polyclonal antibody (A01)

Ref: AB-H00022931-A01
RAB18 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAB18.
Información adicional
Size 50 uL
Gene Name RAB18
Gene Alias RAB18LI1
Gene Description RAB18, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB18 (AAH15014, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22931

Enviar uma mensagem


RAB18 polyclonal antibody (A01)

RAB18 polyclonal antibody (A01)