ATF6 monoclonal antibody (M03), clone 3D5
  • ATF6 monoclonal antibody (M03), clone 3D5

ATF6 monoclonal antibody (M03), clone 3D5

Ref: AB-H00022926-M03
ATF6 monoclonal antibody (M03), clone 3D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ATF6.
Información adicional
Size 100 ug
Gene Name ATF6
Gene Alias ATF6A
Gene Description activating transcription factor 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq QPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATF6 (AAH14969.1, 91 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22926
Clone Number 3D5
Iso type IgG2a Kappa

Enviar uma mensagem


ATF6 monoclonal antibody (M03), clone 3D5

ATF6 monoclonal antibody (M03), clone 3D5