CD93 monoclonal antibody (M04), clone 1A4
  • CD93 monoclonal antibody (M04), clone 1A4

CD93 monoclonal antibody (M04), clone 1A4

Ref: AB-H00022918-M04
CD93 monoclonal antibody (M04), clone 1A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD93.
Información adicional
Size 100 ug
Gene Name CD93
Gene Alias C1QR1|C1qR(P)|C1qRP|CDw93|MXRA4|dJ737E23.1
Gene Description CD93 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD93 (NP_036204, 33 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22918
Clone Number 1A4
Iso type IgG3 Lambda

Enviar uma mensagem


CD93 monoclonal antibody (M04), clone 1A4

CD93 monoclonal antibody (M04), clone 1A4