NCBP2 monoclonal antibody (M02), clone 3A12
  • NCBP2 monoclonal antibody (M02), clone 3A12

NCBP2 monoclonal antibody (M02), clone 3A12

Ref: AB-H00022916-M02
NCBP2 monoclonal antibody (M02), clone 3A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NCBP2.
Información adicional
Size 100 ug
Gene Name NCBP2
Gene Alias CBC2|CBP20|NIP1|PIG55
Gene Description nuclear cap binding protein subunit 2, 20kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCBP2 (NP_031388, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22916
Clone Number 3A12
Iso type IgG1 Kappa

Enviar uma mensagem


NCBP2 monoclonal antibody (M02), clone 3A12

NCBP2 monoclonal antibody (M02), clone 3A12