RALY purified MaxPab mouse polyclonal antibody (B01P)
  • RALY purified MaxPab mouse polyclonal antibody (B01P)

RALY purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00022913-B01P
RALY purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RALY protein.
Información adicional
Size 50 ug
Gene Name RALY
Gene Alias HNRPCL2|MGC117312|P542
Gene Description RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse))
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARAAVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGASGGGGGGGGSGGGGSGGGGGGGSSR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RALY (AAI03754.1, 1 a.a. ~ 307 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22913

Enviar uma mensagem


RALY purified MaxPab mouse polyclonal antibody (B01P)

RALY purified MaxPab mouse polyclonal antibody (B01P)