EPN2 polyclonal antibody (A01)
  • EPN2 polyclonal antibody (A01)

EPN2 polyclonal antibody (A01)

Ref: AB-H00022905-A01
EPN2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EPN2.
Información adicional
Size 50 uL
Gene Name EPN2
Gene Alias EHB21|KIAA1065
Gene Description epsin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPN2 (NP_683723, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22905

Enviar uma mensagem


EPN2 polyclonal antibody (A01)

EPN2 polyclonal antibody (A01)