ARSG purified MaxPab mouse polyclonal antibody (B01P)
  • ARSG purified MaxPab mouse polyclonal antibody (B01P)

ARSG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00022901-B01P
ARSG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARSG protein.
Información adicional
Size 50 ug
Gene Name ARSG
Gene Alias KIAA1001
Gene Description arylsulfatase G
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASEGMRFVDFHAAASTCSPSRASLLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARSG (NP_055775.2, 1 a.a. ~ 525 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22901

Enviar uma mensagem


ARSG purified MaxPab mouse polyclonal antibody (B01P)

ARSG purified MaxPab mouse polyclonal antibody (B01P)