ZNF365 MaxPab mouse polyclonal antibody (B01P)
  • ZNF365 MaxPab mouse polyclonal antibody (B01P)

ZNF365 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00022891-B01P
ZNF365 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF365 protein.
Información adicional
Size 50 ug
Gene Name ZNF365
Gene Alias KIAA0844|MGC41821|MGC87345|Su48|UAN|ZNF365D
Gene Description zinc finger protein 365
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTVEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKSHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF365 (AAH70073.1, 1 a.a. ~ 276 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22891

Enviar uma mensagem


ZNF365 MaxPab mouse polyclonal antibody (B01P)

ZNF365 MaxPab mouse polyclonal antibody (B01P)