DZIP1 polyclonal antibody (A01)
  • DZIP1 polyclonal antibody (A01)

DZIP1 polyclonal antibody (A01)

Ref: AB-H00022873-A01
DZIP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DZIP1.
Información adicional
Size 50 uL
Gene Name DZIP1
Gene Alias DZIP|DZIPt1|KIAA0996|RP11-23E3.3
Gene Description DAZ interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEELGQRLQEQNELIITQRQQIKDFTCNPLNSI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DZIP1 (NP_945319, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22873

Enviar uma mensagem


DZIP1 polyclonal antibody (A01)

DZIP1 polyclonal antibody (A01)