NLGN1 monoclonal antibody (M01), clone 2G7
  • NLGN1 monoclonal antibody (M01), clone 2G7

NLGN1 monoclonal antibody (M01), clone 2G7

Ref: AB-H00022871-M01
NLGN1 monoclonal antibody (M01), clone 2G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NLGN1.
Información adicional
Size 100 ug
Gene Name NLGN1
Gene Alias KIAA1070|MGC45115
Gene Description neuroligin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NLGN1 (NP_055747, 578 a.a. ~ 677 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22871
Clone Number 2G7
Iso type IgG1 Kappa

Enviar uma mensagem


NLGN1 monoclonal antibody (M01), clone 2G7

NLGN1 monoclonal antibody (M01), clone 2G7