LPHN1 monoclonal antibody (M03), clone 4E12
  • LPHN1 monoclonal antibody (M03), clone 4E12

LPHN1 monoclonal antibody (M03), clone 4E12

Ref: AB-H00022859-M03
LPHN1 monoclonal antibody (M03), clone 4E12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant LPHN1.
Información adicional
Size 100 ug
Gene Name LPHN1
Gene Alias CIRL1|CL1|LEC2
Gene Description latrophilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGLASHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LPHN1 (AAH19928, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22859
Clone Number 4E12
Iso type IgG2a Kappa

Enviar uma mensagem


LPHN1 monoclonal antibody (M03), clone 4E12

LPHN1 monoclonal antibody (M03), clone 4E12