ICK polyclonal antibody (A01)
  • ICK polyclonal antibody (A01)

ICK polyclonal antibody (A01)

Ref: AB-H00022858-A01
ICK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant ICK.
Información adicional
Size 50 uL
Gene Name ICK
Gene Alias KIAA0936|LCK2|MGC46090|MRK
Gene Description intestinal cell (MAK-like) kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ICK (AAH35807, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22858

Enviar uma mensagem


ICK polyclonal antibody (A01)

ICK polyclonal antibody (A01)