VASH1 monoclonal antibody (M05), clone 4A3
  • VASH1 monoclonal antibody (M05), clone 4A3

VASH1 monoclonal antibody (M05), clone 4A3

Ref: AB-H00022846-M05
VASH1 monoclonal antibody (M05), clone 4A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VASH1.
Información adicional
Size 100 ug
Gene Name VASH1
Gene Alias KIAA1036
Gene Description vasohibin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq GGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VASH1 (NP_055724, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22846
Clone Number 4A3
Iso type IgG2a Kappa

Enviar uma mensagem


VASH1 monoclonal antibody (M05), clone 4A3

VASH1 monoclonal antibody (M05), clone 4A3